PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G002800.1
Common NameB456_001G002800, LOC105769604
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 442aa    MW: 48705.2 Da    PI: 7.2517
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G002800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.72e-31233288156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+p LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Gorai.001G002800.1 233 KARRCWSPHLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 288
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.103230290IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-27231291IPR009057Homeodomain-like
SuperFamilySSF466891.1E-16231291IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-26233288IPR006447Myb domain, plants
PfamPF002496.2E-6235286IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MASSSSSELT LDCKPHGHFA APSKCYADQQ QIVVVNHTLK LEDYLSRLEE ERLKIDAFKR  60
ELPLCMQLLT NALESSRQQL QAYRANQGPK PVLEEFMPLK TSVSENMDKF QTISDHKANW  120
MTTAQLWSQA GHYETKPQSS SITTSSPKDT DIGLNVVSPK LGSSLDSKQR IGGAFLPFSK  180
DRNSCSTALP DLSLASSDTE NGTSCQQRDD GTSNNRTDGQ TTNGSNTNQP HRKARRCWSP  240
HLHRRFVNAL QMLGGSQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSPIPQAAG  300
APTPQLVVLG GIWVPPEYAT AAHSGDPALY GAHHHHHPAV PHAPPHFCAS PVPQEFYTTA  360
ATPALPPPHH TFHHQLHNMY NARNSPEPDV REAGDRSESI EDGKSESGSW KGESCGDQRI  420
GLAALREEGE ESNRSEITLK F*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6150640.0JX615064.1 Gossypium hirsutum clone NBRI_GE58863 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446204.10.0PREDICTED: probable transcription factor GLK2
TrEMBLA0A0D2PJX00.0A0A0D2PJX0_G
STRINGPOPTR_0018s06410.11e-168(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM71342843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-116G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]